PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0032s0540.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1716aa    MW: 192712 Da    PI: 5.7105
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0032s0540.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-192883257
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             kR+  t+ ql++Le++++ + yps+e+r+eL++klgL++rq ++WF+ rR k+kk
  SapurV1A.0032s0540.4.p 28 PKRQMKTPFQLQTLEKAYATDTYPSEEMRAELSDKLGLSDRQLQMWFCHRRLKDKK 83
                            69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-19884IPR009057Homeodomain-like
SuperFamilySSF466898.55E-171984IPR009057Homeodomain-like
PROSITE profilePS5007117.0862484IPR001356Homeobox domain
SMARTSM003899.9E-202688IPR001356Homeobox domain
PfamPF000464.7E-172883IPR001356Homeobox domain
CDDcd000863.55E-152984No hitNo description
PROSITE profilePS5082716.539514573IPR018501DDT domain
SMARTSM005714.0E-21514573IPR018501DDT domain
PfamPF027919.9E-17515570IPR018501DDT domain
PfamPF050665.5E-15696764IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.4E-6904948IPR028942WHIM1 domain
PfamPF156139.0E-1310871159IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1716 aa     Download sequence    Send to blast
MEEANSEGEN HSKSKSNALN SNEDQGKPKR QMKTPFQLQT LEKAYATDTY PSEEMRAELS  60
DKLGLSDRQL QMWFCHRRLK DKKETPVKQR KAAPLHESPL EDMRIVGADS GSDYGSGSAS  120
GSSPLSESRK VVLDDGHTMK RYYESSPRSV MELRAIACVE AQLGEPLRED GPILGMKFDS  180
LPPDAFGEPI AITEQPKRMG YSYEDKVYER RDAKSSKDPA ITRSDTYGPH IQSPYHDSPV  240
DTLRGRASPF GVGQTPHARL LSQQDKSGHV FLSPQRDDDY LLQQDTFTNN RTSAQSISHP  300
IMGPENSNVF SDAQTFHNDT ELQLERKRRI DEPRTSREVE AYEIRIRKEL EKQDILRRKN  360
EERMRKEMER HDRERRKEEE RSMRDRQREE ERLLREQKRE LERREKFMQK EYLKAEKIRQ  420
KEELRREKEA VKRKAAMEKA TARKIAKDSL DLIEDEQLEL MELTAASKGL ASIVNLDYDT  480
LQNLDSFRDM LITFPSEAVQ LKKSFGFQPW LDSEENIGNL LMVWKFFITF ADVLGLWPFT  540
LNEFVQAFHD YDSRLLGELH VALLKLIIKD IEDVARTPSS GLGINQYYTA NPEGGHPQIV  600
QGAYTWGFDI RNWQQHLNSL TWPEILRQLA LSAGFGPRLK KKSTTWAGLG DIDEVKDCED  660
IVSIIRNGSA AENAFALMRE KGLLLPRRSR HRLTPGTVKF AAFHVLSLEG SKGLTVLELA  720
DKIQKSGLRD LTTSKTPEAS ISVALTRDQK LFERIAPSTY CARAAFRKDP ADAEAILAEA  780
RKKIRIFENG FLGGENADDV ERDEDSEGDA DEDPEVDDLA TPVSSNKSTV HSGKVNALSG  840
SGSGKVSNDT SSTVQHKCEK GLSSFSLNGP KDAVAPSIIE QCVTHKNEGT NNADEENIEI  900
DESNSGESWI QGLTEGEYSH LSVEERLSAL VVLVGISNEG NTIRAVLEDR LEAANVLKKQ  960
MWGEAQLDRS RLKEEFISKL DFPTFTGSKV ETQVASSAVE GSQSPLVLAD GKSKEASPSN  1020
TEDQKSLPED AENNVSCALS EKALVIQDLS MNPDNISAQQ HGYASKRSRS QLKAYIAHLA  1080
EEMYIYRSLP LGQDRRRNRY WQFVASASRN DPCSGRIFVE LHNGSWRVID SEEAFDTFLS  1140
SLDTRGIRES HLCIMLQKIE SSFKENVRRN LGTANIVCQS GTTDEKETAE TDTANCSAGN  1200
SPGSTVCVSS SDTLDAFSLF SIELGRNSAE KKGSLKRYQD FQNWVWKECF NSSTLRAMKY  1260
GNKRCEQLLD TCDLCLDTYL SEDTHCLSCH KTFKFENKKF DFAEHEIQCK VKRKIDPGNA  1320
CTCDSSLPPG TRLLTALLSC IEVSVPQEAL ESFWMGIPRK DWGMKLAMPS STEELLQILT  1380
VFESAIKRER LSSNFETTKE LLGSSALVGS AAHDSASLGL VSVLPWMPKT TAAVALRLFE  1440
LDASIIYVKE EKPEPSADKP VKLYMKLSSR YSPFKNEEVE LKDVKHEEHI KEDIVDLRGK  1500
QSSHKRGRGG RDQGPATKGQ RRMPGLKSDT GKQRSRGIQN LNQGPRQQGK KTNLQATSRG  1560
RRTVRKRRVE KMQPKEPLVG QMTGMASSMS YLSKKTAVHN RYVKSFRNLG DEDWSVKKGR  1620
VNGDENSNMM EEAESDDNAE ELYGKGNWKP GGSNGWNRNS MEASDDDENA SNGIEAMRDD  1680
DSEGDMEMSD GSDRAAANRV QNDGVDSADS DEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRLKDKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001229.10.0PREDICTED: uncharacterized protein LOC105108578 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLU5G1470.0U5G147_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1